SUMO2 monoclonal antibody (M06), clone 2H8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant SUMO2.
Immunogen
SUMO2 (AAH08450, 1 a.a. ~ 95 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MADEKPKEGVKTENNNHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.19 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SUMO2 expression in transfected 293T cell line by SUMO2 monoclonal antibody (M06), clone 2H8.
Lane 1: SUMO2 transfected lysate(10.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SUMO2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.5 ug/ml]ELISA
-
Gene Info — SUMO2
Entrez GeneID
6613GeneBank Accession#
BC008450Protein Accession#
AAH08450Gene Name
SUMO2
Gene Alias
HSMT3, MGC117191, SMT3B, SMT3H2
Gene Description
SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae)
Omim ID
603042Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last two amino acids of the carboxy-terminus have been cleaved off. Numerous pseudogenes have been reported for this gene. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
Other Designations
SMT3 suppressor of mif two 3 homolog 2|sentrin 2|small ubiquitin-like modifier 2, isoform a
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com