Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SUMO2 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00006613-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human SUMO2 protein.
  • Immunogen:
  • SUMO2 (NP_008868.3, 1 a.a. ~ 95 a.a) full-length human protein.
  • Sequence:
  • MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SUMO2 expression in transfected 293T cell line (H00006613-T02) by SUMO2 MaxPab polyclonal antibody.

    Lane 1: SUMO2 transfected lysate(10.90 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6613
  • Gene Name:
  • SUMO2
  • Gene Alias:
  • HSMT3,MGC117191,SMT3B,SMT3H2
  • Gene Description:
  • SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae)
  • Gene Summary:
  • This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last two amino acids of the carboxy-terminus have been cleaved off. Numerous pseudogenes have been reported for this gene. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
  • Other Designations:
  • SMT3 suppressor of mif two 3 homolog 2,sentrin 2,small ubiquitin-like modifier 2, isoform a
  • RSS
  • YouTube
  • Linkedin
  • Facebook