Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SUMO3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00006612-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SUMO3 partial ORF ( NP_008867, 1 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.07
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006612-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6612
  • Gene Name:
  • SUMO3
  • Gene Alias:
  • SMT3A,SMT3H1,SUMO-3
  • Gene Description:
  • SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae)
  • Gene Summary:
  • SUMO proteins, such as SUMO3, and ubiquitin (see MIM 191339) posttranslationally modify numerous cellular proteins and affect their metabolism and function. However, unlike ubiquitination, which targets proteins for degradation, sumoylation participates in a number of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability (Su and Li, 2002 [PubMed 12383504]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000115275,SMT3 suppressor of mif two 3 homolog 1,small ubiquitin-like modifier protein 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook