Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SUMO3 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00006612-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human SUMO3 protein.
  • Immunogen:
  • SUMO3 (AAH08420, 1 a.a. ~ 103 a.a) full-length human protein.
  • Sequence:
  • MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SUMO3 expression in transfected 293T cell line (H00006612-T01) by SUMO3 MaxPab polyclonal antibody.

    Lane 1: SUMO3 transfected lysate(11.33 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6612
  • Gene Name:
  • SUMO3
  • Gene Alias:
  • SMT3A,SMT3H1,SUMO-3
  • Gene Description:
  • SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae)
  • Gene Summary:
  • SUMO proteins, such as SUMO3, and ubiquitin (see MIM 191339) posttranslationally modify numerous cellular proteins and affect their metabolism and function. However, unlike ubiquitination, which targets proteins for degradation, sumoylation participates in a number of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability (Su and Li, 2002 [PubMed 12383504]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000115275,SMT3 suppressor of mif two 3 homolog 1,small ubiquitin-like modifier protein 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook