SMS monoclonal antibody (M01), clone 1G6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SMS expression in transfected 293T cell line by SMS monoclonal antibody (M01), clone 1G6.
Lane 1: SMS transfected lysate(41.268 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SMS is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (66 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant SMS.
Immunogen
SMS (AAH09898.1, 1 a.a. ~ 366 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAAARHSTLDFMLGAKADGETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSYDGDAQGKEEIDSILNKVEERMKELSQDSTGRVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSPEEDSTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKKAKP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (97)
Isotype
IgG2a kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (66 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SMS expression in transfected 293T cell line by SMS monoclonal antibody (M01), clone 1G6.
Lane 1: SMS transfected lysate(41.268 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SMS is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — SMS
Entrez GeneID
6611GeneBank Accession#
BC009898Protein Accession#
AAH09898.1Gene Name
SMS
Gene Alias
MRSR, SPMSY, SRS, SpS
Gene Description
spermine synthase
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the spermidine/spermine synthases family. This gene encodes an ubiquitous enzyme of polyamine metabolism. [provided by RefSeq
Other Designations
spermidine aminopropyltransferase
-
Interactome
-
Pathway
-
Publication Reference
-
Modeling Snyder-Robinson Syndrome in multipotent stromal cells reveals impaired mitochondrial function as a potential cause for deficient osteogenesis.
Ramsay AL, Alonso-Garcia V, Chaboya C, Radut B, Le B, Florez J, Schumacher C, Fierro FA.
Scientific Reports 2019 Oct; 9(1):15395.
Application：WB, Human, Human bone marrow-derived multipotent stromal cells.
-
A Y328C missense mutation in spermine synthase causes a mild form of Snyder-Robinson syndrome.
Zhang Z, Norris J, Kalscheuer V, Wood T, Wang L, Schwartz C, Alexov E, Van Esch H.
Human Molecular Genetics 2013 Sep; 22(18):3789.
Application：WB-Ce, Human, Lymphoblast cells.
-
Modeling Snyder-Robinson Syndrome in multipotent stromal cells reveals impaired mitochondrial function as a potential cause for deficient osteogenesis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com