SMARCD3 monoclonal antibody (M01A), clone 1G6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SMARCD3.
Immunogen
SMARCD3 (NP_001003801, 385 a.a. ~ 483 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ISALDSKIHETIESINQLKIQRDFMLSFSRDPKGYVQDLLRSQSRDLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLVVRNT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In ascites fluid
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SMARCD3 monoclonal antibody (M01A), clone 1G6 Western Blot analysis of SMARCD3 expression in K-562 ( Cat # L009V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — SMARCD3
Entrez GeneID
6604GeneBank Accession#
NM_001003801Protein Accession#
NP_001003801Gene Name
SMARCD3
Gene Alias
BAF60C, CRACD3, MGC111010, Rsc6p
Gene Description
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3
Omim ID
601737Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined. [provided by RefSeq
Other Designations
60kDa BRG-1/Brm associated factor subunit c|SWI/SNF complex 60 kDa subunit C|SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3, isoform 1|Swp73-like protein|chromatin remodeling complex BAF60C subunit|mammal
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com