SMARCD2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SMARCD2 partial ORF ( NP_003068, 398 a.a. - 474 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
34.21
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SMARCD2
Entrez GeneID
6603GeneBank Accession#
NM_003077Protein Accession#
NP_003068Gene Name
SMARCD2
Gene Alias
BAF60B, CRACD2, PRO2451, Rsc6p
Gene Description
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2
Omim ID
601736Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
SWI/SNF complex 60 kDa subunit B|SWI/SNF-related matrix-associated actin-dependent regulator of chromatin d2|Swp73-like protein|chromatin remodeling complex BAF60B subunit|mammalian chromatin remodeling complex BRG1-associated factor 60B
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com