Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SMARCC1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00006599-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SMARCC1 partial ORF ( NP_003065, 338 a.a. - 437 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • ESRKKSGKKGQASLYGKRRSQKEEDEQEDLTKDMEDPTPVPNIEEVVLPKNVNLKKDSENTPVKGGTVADLDEQDEETVTAGGKEDEDPAKGDQSRSVDL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006599-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6599
  • Gene Name:
  • SMARCC1
  • Gene Alias:
  • BAF155,CRACC1,Rsc8,SRG3,SWI3
  • Gene Description:
  • SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1
  • Gene Summary:
  • The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and contains a predicted leucine zipper motif typical of many transcription factors. [provided by RefSeq
  • Other Designations:
  • SWI/SNF complex 155 kDa subunit,SWI/SNF-related matrix-associated actin-dependent regulator of chromatin c1,chromatin remodeling complex BAF155 subunit,mammalian chromatin remodeling complex BRG1-associated factor 155
  • RSS
  • YouTube
  • Linkedin
  • Facebook