Product Browser

Last updated: 2016/11/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SMARCB1 monoclonal antibody (M14), clone 2H1

  • Catalog # : H00006598-M14
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant SMARCB1.
  • Immunogen:
  • SMARCB1 (NP_002922, 123 a.a. ~ 202 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • VPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006598-M14
    Western Blot detection against Immunogen (34.80 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SMARCB1 monoclonal antibody (M14), clone 2H1. Western Blot analysis of SMARCB1 expression in IMR-32 ( Cat # L008V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6598
  • Gene Name:
  • SMARCB1
  • Gene Alias:
  • BAF47,INI1,RDT,SNF5,SNF5L1,Sfh1p,Snr1,hSNFS
  • Gene Description:
  • SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
  • Gene Summary:
  • The protein encoded by this gene is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • integrase interactor 1,malignant rhabdoid tumor suppressor,sucrose nonfermenting, yeast, homolog-like 1
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook