SMARCB1 monoclonal antibody (M13), clone 3B9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SMARCB1 expression in transfected 293T cell line by SMARCB1 monoclonal antibody (M13), clone 3B9.
Lane 1: SMARCB1 transfected lysate(44.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (34.80 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant SMARCB1.
Immunogen
SMARCB1 (NP_002922, 123 a.a. ~ 202 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNE
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.80 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SMARCB1 expression in transfected 293T cell line by SMARCB1 monoclonal antibody (M13), clone 3B9.
Lane 1: SMARCB1 transfected lysate(44.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — SMARCB1
Entrez GeneID
6598GeneBank Accession#
NM_002931Protein Accession#
NP_002922Gene Name
SMARCB1
Gene Alias
BAF47, INI1, RDT, SNF5, SNF5L1, Sfh1p, Snr1, hSNFS
Gene Description
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
Omim ID
601607Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
integrase interactor 1|malignant rhabdoid tumor suppressor|sucrose nonfermenting, yeast, homolog-like 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com