SMARCA4 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SMARCA4 partial ORF ( NP_003063, 1451 a.a. - 1550 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
LSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Interspecies Antigen Sequence
Mouse (100); Rat (99)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SMARCA4
Entrez GeneID
6597GeneBank Accession#
NM_003072Protein Accession#
NP_003063Gene Name
SMARCA4
Gene Alias
BAF190, BRG1, FLJ39786, SNF2, SNF2-BETA, SNF2L4, SNF2LB, SWI2, hSNF2b
Gene Description
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
Omim ID
603254Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the SWI/SNF family of proteins and is similar to the brahma protein of Drosophila. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. In addition, this protein can bind BRCA1, as well as regulate the expression of the tumorigenic protein CD44. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
ATP-dependent helicase SMARCA4|BRM/SWI2-related gene 1|SNF2-like 4|SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a4|brahma protein-like 1|global transcription activator homologous sequence|homeotic gene regulator|mitotic growth
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com