Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SMARCA4 polyclonal antibody (A01)

  • Catalog # : H00006597-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SMARCA4.
  • Immunogen:
  • SMARCA4 (NP_003063, 1451 a.a. ~ 1550 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • LSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6597
  • Gene Name:
  • SMARCA4
  • Gene Alias:
  • BAF190,BRG1,FLJ39786,SNF2,SNF2-BETA,SNF2L4,SNF2LB,SWI2,hSNF2b
  • Gene Description:
  • SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
  • Gene Summary:
  • The protein encoded by this gene is a member of the SWI/SNF family of proteins and is similar to the brahma protein of Drosophila. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. In addition, this protein can bind BRCA1, as well as regulate the expression of the tumorigenic protein CD44. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • ATP-dependent helicase SMARCA4,BRM/SWI2-related gene 1,SNF2-like 4,SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a4,brahma protein-like 1,global transcription activator homologous sequence,homeotic gene regulator,mitotic growth
  • RSS
  • YouTube
  • Linkedin
  • Facebook