Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SMARCA3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00006596-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SMARCA3 partial ORF ( NP_003062, 932 a.a. - 1009 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • PAWNPAAEDQCFDRCHRLGQKQEVIITKFIVKDSVEENMLKIQNKKRELAAGAFGTKKPNADEMKQAKINEIRTLIDL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 34.32
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006596-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6596
  • Gene Name:
  • HLTF
  • Gene Alias:
  • HIP116,HIP116A,HLTF1,RNF80,SMARCA3,SNF2L3,ZBU1
  • Gene Description:
  • helicase-like transcription factor
  • Gene Summary:
  • This gene encodes a member of the SWI/SNF family. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein contains a RING finger DNA binding motif. Two transcript variants encoding the same protein have been found for this gene. However, use of an alternative translation start site produces an isoform that is truncated at the N-terminus compared to the full-length protein. [provided by RefSeq
  • Other Designations:
  • DNA-binding protein/plasminogen activator inhibitor-1 regulator,SNF2-like 3,SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 3,sucrose nonfermenting-like 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook