Product Browser

Last updated: 2017/6/18
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SMARCA3 polyclonal antibody (A01)

  • Catalog # : H00006596-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SMARCA3.
  • Immunogen:
  • SMARCA3 (NP_003062, 932 a.a. ~ 1009 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • PAWNPAAEDQCFDRCHRLGQKQEVIITKFIVKDSVEENMLKIQNKKRELAAGAFGTKKPNADEMKQAKINEIRTLIDL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006596-A01
    Western Blot detection against Immunogen (34.69 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6596
  • Gene Name:
  • HLTF
  • Gene Alias:
  • HIP116,HIP116A,HLTF1,RNF80,SMARCA3,SNF2L3,ZBU1
  • Gene Description:
  • helicase-like transcription factor
  • Gene Summary:
  • This gene encodes a member of the SWI/SNF family. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein contains a RING finger DNA binding motif. Two transcript variants encoding the same protein have been found for this gene. However, use of an alternative translation start site produces an isoform that is truncated at the N-terminus compared to the full-length protein. [provided by RefSeq
  • Other Designations:
  • DNA-binding protein/plasminogen activator inhibitor-1 regulator,SNF2-like 3,SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 3,sucrose nonfermenting-like 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook