Product Browser

Last updated: 2017/10/22
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SNAI2 monoclonal antibody (M05), clone 3C12

  • Catalog # : H00006591-M05
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant SNAI2.
  • Immunogen:
  • SNAI2 (NP_003059, 97 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • KDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYV
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse, Rat
  • Isotype:
  • IgG3 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006591-M05
    Western Blot detection against Immunogen (33.77 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • SNAI2 monoclonal antibody (M05), clone 3C12. Western Blot analysis of SNAI2 expression in human liver.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SNAI2 monoclonal antibody (M05), clone 3C12. Western Blot analysis of SNAI2 expression in PC-12(Cat # L012V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SNAI2 monoclonal antibody (M05), clone 3C12 Western Blot analysis of SNAI2 expression in HepG2 ( Cat # L019V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SNAI2 monoclonal antibody (M05), clone 3C12. Western Blot analysis of SNAI2 expression in Raw 264.7(Cat # L024V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SNAI2 monoclonal antibody (M05), clone 3C12. Western Blot analysis of SNAI2 expression in NIH/3T3(Cat # L018V1 ).
  • PDF DownloadProtocol Download
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescence of monoclonal antibody to SNAI2 on U-2 OS cell. [antibody concentration 10 ug/ml]
  • PDF DownloadProtocol Download
  • ELISA
  • Immunofluorescence (Circulating Tumor Cell)
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Immunofluorescence (Circulating Tumor Cell)
  • Gene Information
  • Entrez GeneID:
  • 6591
  • Gene Name:
  • SNAI2
  • Gene Alias:
  • MGC10182,SLUG,SLUGH1,WS2D
  • Gene Description:
  • snail homolog 2 (Drosophila)
  • Gene Summary:
  • This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000195093,neural crest transcription factor SLUG,slug (chicken homolog), zinc finger protein,slug homolog, zinc finger protein,snail 2
  • Gene Pathway
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook