Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLPI (Human) Recombinant Protein (P01)

  • Catalog # : H00006590-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SLPI full-length ORF ( AAH20708, 26 a.a. - 132 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • SGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.51
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006590-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6590
  • Gene Name:
  • SLPI
  • Gene Alias:
  • ALK1,ALP,BLPI,HUSI,HUSI-I,MPI,WAP4,WFDC4
  • Gene Description:
  • secretory leukocyte peptidase inhibitor
  • Gene Summary:
  • This gene encodes a secreted inhibitor which protects epithelial tissues from serine proteases. It is found in various secretions including seminal plasma, cervical mucus, and bronchial secretions, and has affinity for trypsin, leukocyte elastase, and cathepsin G. Its inhibitory effect contributes to the immune response by protecting epithelial surfaces from attack by endogenous proteolytic enzymes; the protein is also thought to have broad-spectrum anti-biotic activity. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000031775,WAP four-disulfide core domain 4,antileukoproteinase,mucus proteinase inhibitor,secretory leukocyte protease inhibitor (antileukoproteinase),seminal proteinase inhibitor
  • RSS
  • YouTube
  • Linkedin
  • Facebook