Product Browser

Last updated: 2017/8/13

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLPI purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00006590-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human SLPI protein.
  • Immunogen:
  • SLPI (ABM85471.1, 1 a.a. ~ 132 a.a) full-length human protein.
  • Sequence:
  • MKSSGLFPFLVLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SLPI expression in transfected 293T cell line (H00006590-T03) by SLPI MaxPab polyclonal antibody.

    Lane 1: SLPI transfected lysate(14.52 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6590
  • Gene Name:
  • SLPI
  • Gene Alias:
  • ALK1,ALP,BLPI,HUSI,HUSI-I,MPI,WAP4,WFDC4
  • Gene Description:
  • secretory leukocyte peptidase inhibitor
  • Gene Summary:
  • This gene encodes a secreted inhibitor which protects epithelial tissues from serine proteases. It is found in various secretions including seminal plasma, cervical mucus, and bronchial secretions, and has affinity for trypsin, leukocyte elastase, and cathepsin G. Its inhibitory effect contributes to the immune response by protecting epithelial surfaces from attack by endogenous proteolytic enzymes; the protein is also thought to have broad-spectrum anti-biotic activity. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000031775,WAP four-disulfide core domain 4,antileukoproteinase,mucus proteinase inhibitor,secretory leukocyte protease inhibitor (antileukoproteinase),seminal proteinase inhibitor
  • RSS
  • YouTube
  • Linkedin
  • Facebook