Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLPI polyclonal antibody (A01)

  • Catalog # : H00006590-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SLPI.
  • Immunogen:
  • SLPI (NP_003055, 33 a.a. ~ 132 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006590-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6590
  • Gene Name:
  • SLPI
  • Gene Alias:
  • ALK1,ALP,BLPI,HUSI,HUSI-I,MPI,WAP4,WFDC4
  • Gene Description:
  • secretory leukocyte peptidase inhibitor
  • Gene Summary:
  • This gene encodes a secreted inhibitor which protects epithelial tissues from serine proteases. It is found in various secretions including seminal plasma, cervical mucus, and bronchial secretions, and has affinity for trypsin, leukocyte elastase, and cathepsin G. Its inhibitory effect contributes to the immune response by protecting epithelial surfaces from attack by endogenous proteolytic enzymes; the protein is also thought to have broad-spectrum anti-biotic activity. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000031775,WAP four-disulfide core domain 4,antileukoproteinase,mucus proteinase inhibitor,secretory leukocyte protease inhibitor (antileukoproteinase),seminal proteinase inhibitor
  • RSS
  • YouTube
  • Linkedin
  • Facebook