Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC22A5 (Human) Recombinant Protein (Q01)

  • Catalog # : H00006584-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SLC22A5 partial ORF ( NP_003051, 511 a.a. - 557 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • ESFGTPLPDTIDQMLRVKGMKHRKTPSHTRMLKDGQERPTILKSTAF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 30.91
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006584-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6584
  • Gene Name:
  • SLC22A5
  • Gene Alias:
  • CDSP,FLJ46769,OCTN2,OCTN2VT
  • Gene Description:
  • solute carrier family 22 (organic cation/carnitine transporter), member 5
  • Gene Summary:
  • Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. The encoded protein is a plasma integral membrane protein which functions both as an organic cation transporter and as a sodium-dependent high affinity carnitine transporter. The encoded protein is involved in the active cellular uptake of carnitine. Mutations in this gene are the cause of systemic primary carnitine deficiency (CDSP), an autosomal recessive disorder manifested early in life by hypoketotic hypoglycemia and acute metabolic decompensation, and later in life by skeletal myopathy or cardiomyopathy. [provided by RefSeq
  • Other Designations:
  • high-affinity sodium dependent carnitine cotransporter,organic cation transporter 2,organic cation transporter 5,organic cation/carnitine transporter 2,solute carrier family 22 (organic cation transporter), member 5,solute carrier family 22 member 5
  • RSS
  • YouTube
  • Linkedin
  • Facebook