SLC22A4 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SLC22A4 partial ORF ( NP_003050, 43 a.a. - 141 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
AGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.63
Interspecies Antigen Sequence
Mouse (78); Rat (81)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SLC22A4
Entrez GeneID
6583GeneBank Accession#
NM_003059Protein Accession#
NP_003050Gene Name
SLC22A4
Gene Alias
MGC34546, MGC40524, OCTN1
Gene Description
solute carrier family 22 (organic cation/ergothioneine transporter), member 4
Gene Ontology
HyperlinkGene Summary
Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. The encoded protein is an organic cation transporter and plasma integral membrane protein containing eleven putative transmembrane domains as well as a nucleotide-binding site motif. Transport by this protein is at least partially ATP-dependent. [provided by RefSeq
Other Designations
integral membrane transport protein|organic cation transporter 4|solute carrier family 22 (organic cation transporter), member 4|solute carrier family 22 member 4
-
Interactome
-
Disease
- Anus Diseases
- Arthritis
- Asthma
- Autoimmune Diseases
- Bronchiolitis
- Cholangitis
- Colitis
- Colorectal Neoplasms
- Crohn Disease
+ View More Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com