SLC22A4 monoclonal antibody (M01), clone 2D3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SLC22A4.
Immunogen
SLC22A4 (NP_003050, 43 a.a. ~ 141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (78); Rat (81)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SLC22A4 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — SLC22A4
Entrez GeneID
6583GeneBank Accession#
NM_003059Protein Accession#
NP_003050Gene Name
SLC22A4
Gene Alias
MGC34546, MGC40524, OCTN1
Gene Description
solute carrier family 22 (organic cation/ergothioneine transporter), member 4
Gene Ontology
HyperlinkGene Summary
Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. The encoded protein is an organic cation transporter and plasma integral membrane protein containing eleven putative transmembrane domains as well as a nucleotide-binding site motif. Transport by this protein is at least partially ATP-dependent. [provided by RefSeq
Other Designations
integral membrane transport protein|organic cation transporter 4|solute carrier family 22 (organic cation transporter), member 4|solute carrier family 22 member 4
-
Interactome
-
Disease
- Anus Diseases
- Arthritis
- Asthma
- Autoimmune Diseases
- Bronchiolitis
- Cholangitis
- Colitis
- Colorectal Neoplasms
- Crohn Disease
+ View More Disease
-
Publication Reference
-
Selective inactivation of hypomethylating agents by SAMHD1 provides a rationale for therapeutic stratification in AML.
Oellerich T, Schneider C, Thomas D, Knecht KM, Buzovetsky O, Kaderali L, Schliemann C, Bohnenberger H, Angenendt L, Hartmann W, Wardelmann E, Rothenburger T, Mohr S, Scheich S, Comoglio F, Wilke A, Ströbel P, Serve H, Michaelis M, Ferreirós N, Geisslinger G, Xiong Y, Keppler OT, Cinatl J Jr.
Nature Communications 2019 Aug; 10(1):3475.
Application:WB-Ce, Human, Human acute myeloid leukemia cells.
-
Selective inactivation of hypomethylating agents by SAMHD1 provides a rationale for therapeutic stratification in AML.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com