SLC22A4 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant SLC22A4.
Immunogen
SLC22A4 (NP_003050, 43 a.a. ~ 141 a.a) partial recombinant protein with GST tag.
Sequence
AGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (78); Rat (81)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SLC22A4 polyclonal antibody (A01), Lot # 061025JCS1. Western Blot analysis of SLC22A4 expression in Daoy.Western Blot (Recombinant protein)
ELISA
-
Gene Info — SLC22A4
Entrez GeneID
6583GeneBank Accession#
NM_003059Protein Accession#
NP_003050Gene Name
SLC22A4
Gene Alias
MGC34546, MGC40524, OCTN1
Gene Description
solute carrier family 22 (organic cation/ergothioneine transporter), member 4
Gene Ontology
HyperlinkGene Summary
Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. The encoded protein is an organic cation transporter and plasma integral membrane protein containing eleven putative transmembrane domains as well as a nucleotide-binding site motif. Transport by this protein is at least partially ATP-dependent. [provided by RefSeq
Other Designations
integral membrane transport protein|organic cation transporter 4|solute carrier family 22 (organic cation transporter), member 4|solute carrier family 22 member 4
-
Interactome
-
Disease
- Anus Diseases
- Arthritis
- Asthma
- Autoimmune Diseases
- Bronchiolitis
- Cholangitis
- Colitis
- Colorectal Neoplasms
- Crohn Disease
+ View More Disease
-
Publication Reference
-
Expression of OATP1A2 in red blood cells and its potential impact on antimalarial therapy.
Hubeny A, Keiser MW, Oswald S, Jedlitschky G, Kroemer HK, Siegmund W, Grube M.
Drug Metabolism and Disposition 2016 Oct; 44(10):1562.
Application:IF, WB-Tr, Human, RBC, MDCKII cells.
-
Expression of OATP1A2 in red blood cells and its potential impact on antimalarial therapy.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com