Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC22A4 polyclonal antibody (A01)

  • Catalog # : H00006583-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SLC22A4.
  • Immunogen:
  • SLC22A4 (NP_003050, 43 a.a. ~ 141 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • AGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006583-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SLC22A4 polyclonal antibody (A01), Lot # 061025JCS1. Western Blot analysis of SLC22A4 expression in Daoy.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6583
  • Gene Name:
  • SLC22A4
  • Gene Alias:
  • MGC34546,MGC40524,OCTN1
  • Gene Description:
  • solute carrier family 22 (organic cation/ergothioneine transporter), member 4
  • Gene Summary:
  • Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. The encoded protein is an organic cation transporter and plasma integral membrane protein containing eleven putative transmembrane domains as well as a nucleotide-binding site motif. Transport by this protein is at least partially ATP-dependent. [provided by RefSeq
  • Other Designations:
  • integral membrane transport protein,organic cation transporter 4,solute carrier family 22 (organic cation transporter), member 4,solute carrier family 22 member 4
  • RSS
  • YouTube
  • Linkedin
  • Facebook