SLC22A2 monoclonal antibody (M02), clone 1E3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
SLC22A2 monoclonal antibody (M02), clone 1E3. Western Blot analysis of SLC22A2 expression in human spleen.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SLC22A2 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.73 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SLC22A2.
Immunogen
SLC22A2 (AAH39899, 261 a.a. ~ 370 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HWRWLQFTVALPNFFFLLYYWCIPESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIRKHTMILMYNWFTSSVLYQGLIKHMG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85); Rat (81)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SLC22A2 monoclonal antibody (M02), clone 1E3. Western Blot analysis of SLC22A2 expression in human spleen.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SLC22A2 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — SLC22A2
Entrez GeneID
6582GeneBank Accession#
BC039899Protein Accession#
AAH39899Gene Name
SLC22A2
Gene Alias
MGC32628, OCT2
Gene Description
solute carrier family 22 (organic cation transporter), member 2
Omim ID
602608Gene Ontology
HyperlinkGene Summary
Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. It is found primarily in the kidney, where it may mediate the first step in cation reabsorption. [provided by RefSeq
Other Designations
OTTHUMP00000017538|organic cation transporter (OCT2)|organic cation transporter 2|solute carrier family 22 member 2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com