Product Browser

Last updated: 2017/10/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC22A3 polyclonal antibody (A01)

  • Catalog # : H00006581-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SLC22A3.
  • Immunogen:
  • SLC22A3 (NP_068812, 90 a.a. ~ 155 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • CQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLD
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006581-A01
    Western Blot detection against Immunogen (33.37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6581
  • Gene Name:
  • SLC22A3
  • Gene Alias:
  • EMT,EMTH,OCT3
  • Gene Description:
  • solute carrier family 22 (extraneuronal monoamine transporter), member 3
  • Gene Summary:
  • Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. [provided by RefSeq
  • Other Designations:
  • EMT organic cation transporter 3,OTTHUMP00000017542,extraneuronal monoamine transporter,organic cation transporter 3,solute carrier family 22 member 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook