SLCO2A1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant SLCO2A1.
Immunogen
SLCO2A1 (NP_005621, 276 a.a. ~ 325 a.a) partial recombinant protein with GST tag.
Sequence
FFFPRAMPIGAKRAPATADEARKLEEAKSRGSLVDFIKRFPCIFLRLLMN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (72); Rat (74)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (31.61 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SLCO2A1 polyclonal antibody (A01), Lot # 060529JCS1 Western Blot analysis of SLCO2A1 expression in HL-60 ( Cat # L014V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — SLCO2A1
Entrez GeneID
6578GeneBank Accession#
NM_005630Protein Accession#
NP_005621Gene Name
SLCO2A1
Gene Alias
OATP2A1, PGT, SLC21A2
Gene Description
solute carrier organic anion transporter family, member 2A1
Omim ID
601460Gene Ontology
HyperlinkGene Summary
O
Other Designations
solute carrier family 21 (prostaglandin transporter), member 2
-
Disease
-
Publication Reference
-
Reduction of prostaglandin transporter predicts poor prognosis associated with angiogenesis in gastric adenocarcinoma.
Takeda S, Tanigawa T, Watanabe T, Tatsuwaki H, Nadatani Y, Otani K, Nagami Y, Tanaka F, Kamata N, Yamagami H, Shiba M, Tominaga K, Fujiwara Y, Muguruma K, Ohira M, Hirakawa K, Arakawa T.
Journal of Gastroenterology and Hepatology 2016 Feb; 31(2):376.
Application:IHC, WB, Human, Gastric adenocarcinoma tissues, AGS, MKN7, MKN45, NUGC3, NCI-N87 cells.
-
The prostaglandin transporter OATP2A1 is expressed in human ocular tissues and transports the antiglaucoma prostanoid latanoprost.
Kraft ME, Glaeser H, Mandery K, Konig J, Auge D, Fromm MF, Schlotzer-Schrehardt U, Welge-Lussen U, Kruse FE, Zolk O.
Investigative Ophthalmology & Visual Science 2010 May; 51(5):2504.
Application:IF, Human, Human eyes.
-
Influence of cyclooxygenase inhibitors on the function of the prostaglandin transporter organic anion-transporting polypeptide 2A1 expressed in human gastroduodenal mucosa.
Mandery K, Bujok K, Schmidt I, Wex T, Treiber G, Malfertheiner P, Rau TT, Amann KU, Brune K, Fromm MF, Glaeser H.
The Journal of Pharmacology and Experimental Therapeutics 2010 Feb; 332(2):345.
Application:IF, IHC-P, WB-Ce, WB-Ti, WB-Tr, Human, Antrum, Corpus, Duodenum, HEK 293 cells, Stomach sections.
-
Reduction of prostaglandin transporter predicts poor prognosis associated with angiogenesis in gastric adenocarcinoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com