Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC12A4 monoclonal antibody (M01), clone 1H6

  • Catalog # : H00006560-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant SLC12A4.
  • Immunogen:
  • SLC12A4 (AAH21193, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFLSPLEASRGIDYYDRNLALFEEELDIRPKVSSLLGKLVSYTNLTQGAKEHEEAESGEGTRR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006560-M01
    Western Blot detection against Immunogen (38.1 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SLC12A4 expression in transfected 293T cell line by SLC12A4 monoclonal antibody (M01), clone 1H6.

    Lane 1: SLC12A4 transfected lysate(120.6 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6560
  • Gene Name:
  • SLC12A4
  • Gene Alias:
  • FLJ40489,KCC1
  • Gene Description:
  • solute carrier family 12 (potassium/chloride transporters), member 4
  • Other Designations:
  • potassium transport protein,potassium/chloride cotransporter 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook