Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC12A1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00006557-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SLC12A1 partial ORF ( NP_000329.1, 80 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • AKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGSISGPKVNRPSLLEIHEQLAKNVAVTPSSADRVANGDGIPGDEQAENKEDDQA
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.97
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006557-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6557
  • Gene Name:
  • SLC12A1
  • Gene Alias:
  • BSC1,MGC48843,NKCC2
  • Gene Description:
  • solute carrier family 12 (sodium/potassium/chloride transporters), member 1
  • Gene Summary:
  • The sodium-potassium-chloride cotransporter isoform 2 is kidney-specific and is found on the apical membrane of the thick ascending limb of Henle's loop and the macula densa. It accounts for most of the NaCl resorption with the stoichiometry of 1Na:1K:2Cl and is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene. [provided by RefSeq
  • Other Designations:
  • NKCC2A variant A,Na-K-2Cl cotransporter,sodium potassium chloride cotransporter 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook