Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC11A1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00006556-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SLC11A1 partial ORF ( NP_000569.2, 308 a.a. - 350 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • QAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVAVDIYQGGV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 30.47
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006556-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6556
  • Gene Name:
  • SLC11A1
  • Gene Alias:
  • LSH,NRAMP,NRAMP1
  • Gene Description:
  • solute carrier family 11 (proton-coupled divalent metal ion transporters), member 1
  • Gene Summary:
  • This gene is a member of the solute carrier family 11 (proton-coupled divalent metal ion transporters) family and encodes a multi-pass membrane protein. The protein functions as a divalent transition metal (iron and manganese) transporter involved in iron metabolism and host resistance to certain pathogens. Mutations in this gene have been associated with susceptibility to infectious diseases such as tuberculosis and leprosy, and inflammatory diseases such as rheumatoid arthritis and Crohn disease. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined. [provided by RefSeq
  • Other Designations:
  • natural resistance-associated macrophage protein 1,solute carrier family 11 (sodium/phosphate symporters), member 1
  • Gene Pathway
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook