Product Browser

Last updated: 2021/1/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

SLC6A8 DNAxPab DNAxPab

  • Catalog # : H00006535-W01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a partial-length human SLC6A8 DNA using DNAx™ Immune technology.
  • Immunogen:
  • SLC6A8 (AAH81558.1, 160 a.a. ~ 230 a.a) partial-length human DNA
  • Sequence:
  • VKSFTTTLPWATCGHTWNTPDCVEIFRHEDCANASLANLTCDQLADRRSPVIEFWENKVLRLSGGLEVPGA
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Purification:
  • Protein A
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Immunofluorescence (Transfected cell)
  • Immunofluorescence (Exosome)
  • Flow Cytometry (Transfected cell)
  • Application Image
  • Immunofluorescence (Transfected cell)
  • Immunofluorescence (Exosome)
  • Flow Cytometry (Transfected cell)
  • Gene Information
  • Entrez GeneID:
  • 6535
  • Gene Name:
  • SLC6A8
  • Gene Alias:
  • CRT,CRTR,CT1,MGC87396
  • Gene Description:
  • solute carrier family 6 (neurotransmitter transporter, creatine), member 8
  • Gene Summary:
  • The protein encoded by this gene is a plasma membrane protein whose function is to transport creatine into and out of cells. Defects in this gene can result in X-linked creatine deficiency syndrome. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000025945,creatine transporter SLC6A8,sodium- and chloride-dependent creatine transporter 1,solute carrier family 6 member 8
  • RSS
  • YouTube
  • Linkedin
  • Facebook