Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SMTN (Human) Recombinant Protein (P01)

  • Catalog # : H00006525-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SMTN full-length ORF ( AAH12026, 1 a.a. - 67 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MGPLTSFRRAPSSSPAKASSAISLAPSSVGSFLVRSPVPVAPVTSSENSAGDRHESGMLGLPETTGT
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 33.11
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006525-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6525
  • Gene Name:
  • SMTN
  • Gene Alias:
  • FLJ35365,FLJ38597
  • Gene Description:
  • smoothelin
  • Gene Summary:
  • This gene encodes a structural protein that is found exclusively in contractile smooth muscle cells. It associates with stress fibers and constitutes part of the cytoskeleton. This gene is localized to chromosome 22q12.3, distal to the TUPLE1 locus and outside the DiGeorge syndrome deletion. Alternative splicing of this gene results in three transcript variants. [provided by RefSeq
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook