SLC5A2 monoclonal antibody (M01), clone 3G8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SLC5A2.
Immunogen
SLC5A2 (NP_003032.1, 228 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88); Rat (90)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (31.24 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SLC5A2 expression in transfected 293T cell line by SLC5A2 monoclonal antibody (M01), clone 3G8.
Lane 1: SLC5A2 transfected lysate(72.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SLC5A2 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — SLC5A2
Entrez GeneID
6524GeneBank Accession#
NM_003041Protein Accession#
NP_003032.1Gene Name
SLC5A2
Gene Alias
SGLT2
Gene Description
solute carrier family 5 (sodium/glucose cotransporter), member 2
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the sodium glucose cotransporter family which are sodium-dependent glucose transport proteins. The encoded protein is the major cotransporter involved in glucose reabsorption in the kidney. Mutations in this gene are associated with renal glucosuria. [provided by RefSeq
Other Designations
OTTHUMP00000163298|low affinity sodium-glucose cotransporter|sodium/glucose cotransporter|solute carrier family 5 (sodium/glucose transporter), member 2
-
Interactome
-
Publication Reference
-
A Fluorescent Glucose Transport Assay for Screening SGLT2 Inhibitors in Endogenous SGLT2-Expressing HK-2 Cells.
Lu YT, Ma XL, Xu YH, Hu J, Wang F, Qin WY, Xiong WY.
Natural Products and Bioprospecting 2018 Nov; [Epub].
Application:WB-Ce, Human, HK-2 cells.
-
A Fluorescent Glucose Transport Assay for Screening SGLT2 Inhibitors in Endogenous SGLT2-Expressing HK-2 Cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com