SLC4A1 monoclonal antibody (M02), clone 2D5

Catalog # H00006521-M02

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 335.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Sandwich ELISA (Recombinant protein)
Application

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged SLC4A1 is 0.1 ng/ml as a capture antibody.

Immunofluorescence
Application

Immunofluorescence

Immunofluorescence of monoclonal antibody to SLC4A1 on HeLa cell . [antibody concentration 10 ug/ml]

QC Test

Western Blot detection against Immunogen (36.74 KDa) .

  • Specification

    Product Description

    Mouse monoclonal antibody raised against a partial recombinant SLC4A1.

    Immunogen

    SLC4A1 (NP_000333.1, 261 a.a. ~ 360 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    PIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPDSSFYK

    Host

    Mouse

    Reactivity

    Human

    Isotype

    IgG1 Kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (36.74 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Recombinant protein)

    Sandwich ELISA (Recombinant protein)

    Detection limit for recombinant GST tagged SLC4A1 is 0.1 ng/ml as a capture antibody.

    ELISA

    Immunofluorescence

    Immunofluorescence of monoclonal antibody to SLC4A1 on HeLa cell . [antibody concentration 10 ug/ml]
  • Gene Info — SLC4A1

    Entrez GeneID

    6521

    GeneBank Accession#

    NM_000342

    Protein Accession#

    NP_000333.1

    Gene Name

    SLC4A1

    Gene Alias

    AE1, BND3, CD233, DI, EMPB3, EPB3, FR, MGC116750, MGC116753, MGC126619, MGC126623, RTA1A, SW, WD, WD1, WR

    Gene Description

    solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group)

    Omim ID

    109270 110500 112010 112050 601550 601551 602722

    Gene Ontology

    Hyperlink

    Gene Summary

    The protein encoded by this gene is part of the anion exchanger (AE) family and is expressed in the erythrocyte plasma membrane, where it functions as a chloride/bicarbonate exchanger involved in carbon dioxide transport from tissues to lungs. The protein comprises two domains that are structurally and functionally distinct. The N-terminal 40kDa domain is located in the cytoplasm and acts as an attachment site for the red cell skeleton by binding ankyrin. The glycosylated C-terminal membrane-associated domain contains 12-14 membrane spanning segments and carries out the stilbene disulphonate-sensitive exchange transport of anions. The cytoplasmic tail at the extreme C-terminus of the membrane domain binds carbonic anhydrase II. The encoded protein associates with the red cell membrane protein glycophorin A and this association promotes the correct folding and translocation of the exchanger. This protein is predominantly dimeric but forms tetramers in the presence of ankyrin. Many mutations in this gene are known in man, and these mutations can lead to two types of disease: destabilization of red cell membrane leading to hereditary spherocytosis, and defective kidney acid secretion leading to distal renal tubular acidosis. Other mutations that do not give rise to disease result in novel blood group antigens, which form the Diego blood group system. Southeast Asian ovalocytosis (SAO, Melanesian ovalocytosis) results from the heterozygous presence of a deletion in the encoded protein and is common in areas where Plasmodium falciparum malaria is endemic. One null mutation in this gene is known, resulting in very severe anemia and nephrocalcinosis. [provided by RefSeq

    Other Designations

    Froese blood group|Swann blood group|Waldner blood group|Wright blood group|anion exchange protein 1|anion exchanger 1|erythrocyte membrane protein band 3|erythroid anion exchange protein|solute carrier family 4, anion exchanger, member 1

  • Interactome
  • Disease
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All