SLC3A2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SLC3A2 partial ORF ( NP_002385.3, 203 a.a. - 312 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
IIVRAPRCRELPAQKWWHTGALYRIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNY
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.84
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SLC3A2
Entrez GeneID
6520GeneBank Accession#
NM_002394Protein Accession#
NP_002385.3Gene Name
SLC3A2
Gene Alias
4F2, 4F2HC, 4T2HC, CD98, CD98HC, MDU1, NACAE
Gene Description
solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2
Omim ID
158070Gene Ontology
HyperlinkGene Summary
This gene is a member of the solute carrier family and encodes a cell surface, transmembrane protein with an alpha amylase domain. The protein exists as the heavy chain of a heterodimer, covalently bound through di-sulfide bonds to one of several possible light chains. It associates with integrins and mediates integrin-dependent signaling related to normal cell growth and tumorigenesis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
Other Designations
4F2 cell-surface antigen heavy chain|4F2 heavy chain|CD98 heavy chain|antigen defined by monoclonal antibody 4F2, heavy chain|antigen identified by monoclonal antibodies 4F2, TRA1.10, TROP4, and T43|heavy chain|lymphocyte activation antigen 4F2 large subu
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com