Product Browser

Last updated: 2017/6/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC3A1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00006519-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SLC3A1 partial ORF ( AAH22386, 211 a.a. - 320 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • FIPNHTSDKHIWFQLSRTRTGKYTDYYIWHDCTHENGKTIPPNNWLSVYGNSSWHFDEVRNQCYFHQFMKEQPDLNFRNPDVQEEIKEILRFWLTKGVDGFSLDAVKFLL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.73
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006519-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6519
  • Gene Name:
  • SLC3A1
  • Gene Alias:
  • ATR1,CSNU1,D2H,FLJ34681,NBAT,RBAT
  • Gene Description:
  • solute carrier family 3 (cystine, dibasic and neutral amino acid transporters, activator of cystine, dibasic and neutral amino acid transport), member 1
  • Gene Summary:
  • This gene encodes a type II membrane glycoprotein which is one of the components of the renal amino acid transporter which transports neutral and basic amino acids in the renal tubule and intestinal tract. Mutations and deletions in this gene are associated with cystinuria. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq
  • Other Designations:
  • B(0,+)-type amino acid transport protein,SLC3A1 variant B,SLC3A1 variant C,SLC3A1 variant D,SLC3A1 variant E,SLC3A1 variant F,SLC3A1 variant G,amino acid transporter 1,solute carrier family 3 (cystine, dibasic and neutral amino acid transporters), member
  • RSS
  • YouTube
  • Linkedin
  • Facebook