Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC2A4 (Human) Recombinant Protein (Q01)

  • Catalog # : H00006517-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SLC2A4 partial ORF ( NP_001033, 467 a.a. - 509 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • RVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 30.47
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006517-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6517
  • Gene Name:
  • SLC2A4
  • Gene Alias:
  • GLUT4
  • Gene Description:
  • solute carrier family 2 (facilitated glucose transporter), member 4
  • Gene Summary:
  • This gene is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is sequestered within the cells of muscle and adipose tissue. Within minutes of insulin stimulation, the protein moves to the cell surface and begins to transport glucose across the cell membrane. Mutations in this gene have been associated with noninsulin-dependent diabetes mellitus (NIDDM). [provided by RefSeq
  • Other Designations:
  • glucose transporter 4,insulin-responsive glucose transporter type 4
  • RSS
  • YouTube
  • Linkedin
  • Facebook