Product Browser

Last updated: 2018/4/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC1A3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00006507-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SLC1A3 partial ORF ( NP_004163.2, 162 a.a. - 237 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • VRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPGS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 34.1
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006507-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6507
  • Gene Name:
  • SLC1A3
  • Gene Alias:
  • EA6,EAAT1,FLJ25094,GLAST,GLAST1
  • Gene Description:
  • solute carrier family 1 (glial high affinity glutamate transporter), member 3
  • Gene Summary:
  • Glutamate and aspartate are excitatory neurotransmitters that have been implicated in a number of pathologic states of the nervous system. Accumulation of extracellular excitatory amino acids can be cytotoxic and may also lower the seizure threshold in epilepsy. EAAT1 (SLC1A3) is a member of a family of high-affinity sodium-dependent transporter molecules that regulate neurotransmitter concentrations at the excitatory glutamatergic synapses of the mammalian central nervous system (Kirschner et al., 1994 [PubMed 8001975]).[supplied by OMIM
  • Other Designations:
  • glutamate transporter variant EAAT1ex9skip
  • RSS
  • YouTube
  • Linkedin
  • Facebook