Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC1A2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00006506-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SLC1A2 partial ORF ( NP_004162, 160 a.a. - 239 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • DEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDG
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 34.54
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006506-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6506
  • Gene Name:
  • SLC1A2
  • Gene Alias:
  • EAAT2,GLT-1
  • Gene Description:
  • solute carrier family 1 (glial high affinity glutamate transporter), member 2
  • Gene Summary:
  • This gene encodes a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Mutations in and decreased expression of this protein are associated with amyotrophic lateral sclerosis. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq
  • Other Designations:
  • excitatory amino acid transporter 2,excitotoxic amino acid transporter 2,glial high affinity glutamate transporter,glutamate/aspartate transporter II,sodium-dependent glutamate/aspartate transporter 2,solute carrier family 1, member 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook