SKP1A monoclonal antibody (M01), clone 1H8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SKP1A.
Immunogen
SKP1A (NP_008861, 53 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVGSTQFCL
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SKP1A monoclonal antibody (M01), clone 1H8 Western Blot analysis of SKP1A expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of SKP1 expression in transfected 293T cell line by SKP1A monoclonal antibody (M01), clone 1H8.
Lane 1: SKP1 transfected lysate(18.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to SKP1A on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — SKP1
Entrez GeneID
6500GeneBank Accession#
NM_006930Protein Accession#
NP_008861Gene Name
SKP1
Gene Alias
EMC19, MGC34403, OCP-II, OCP2, SKP1A, TCEB1L, p19A
Gene Description
S-phase kinase-associated protein 1
Omim ID
601434Gene Ontology
HyperlinkGene Summary
This gene encodes a component of SCF complexes, which are composed of this protein, cullin 1, a ring-box protein, and one member of the F-box family of proteins. This protein binds directly to the F-box motif found in F-box proteins. SCF complexes are involved in the regulated ubiquitination of specific protein substrates, which targets them for degradation by the proteosome. Specific F-box proteins recognize different target protein(s), and many specific SCF substrates have been identified including regulators of cell cycle progression and development. Studies have also characterized the protein as an RNA polymerase II elongation factor. Alternative splicing of this gene results in two transcript variants. A related pseudogene has been identified on chromosome 7. [provided by RefSeq
Other Designations
RNA polymerase II elongation factor-like protein OCP2|cyclin A/CDK2-associated p19|organ of Corti protein 2|transcription elongation factor B (SIII), polypeptide 1-like
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Finding of bands of higher molecular weight than expected in three proteins in bovine preimplantation embryos.
Kinterova V, Petruskova V, Kanka J, Toralova T.
Zygote (Cambridge, England) 2019 Jun; 27(3):187.
Application:WB, Bovine, Fibroblasts, Preimplantation embryos.
-
Finding of bands of higher molecular weight than expected in three proteins in bovine preimplantation embryos.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com