Product Browser

Last updated: 2017/8/13

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SKIV2L monoclonal antibody (M05A), clone 1E5

  • Catalog # : H00006499-M05A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant SKIV2L.
  • Immunogen:
  • SKIV2L (NP_008860, 1125 a.a. ~ 1233 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • DQLPNTLKQGIERVRAVAKRIGEVQVACGLNQTVEEFVGELNFGLVEVVYEWARGMPFSELAGLSGTPEGLVVRCIQRLAEMCRSLRGAARLVGEPVLGAKMETAATLL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006499-M05A
    Western Blot detection against Immunogen (37.73 KDa) .
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SKIV2L monoclonal antibody (M05A), clone 1E5. Western Blot analysis of SKIV2L expression in Hela S3 NE.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SKIV2L expression in transfected 293T cell line by SKIV2L monoclonal antibody (M05A), clone 1E5.

    Lane 1: SKIV2L transfected lysate (Predicted MW: 137.06 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6499
  • Gene Name:
  • SKIV2L
  • Gene Alias:
  • 170A,DDX13,HLP,SKI2,SKI2W,SKIV2
  • Gene Description:
  • superkiller viralicidic activity 2-like (S. cerevisiae)
  • Gene Summary:
  • DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a human homologue of yeast SKI2 and may be involved in antiviral activity by blocking translation of poly(A) deficient mRNAs. This gene is located in the class III region of the major histocompatibility complex. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000029197,helicase SKI2W,superkiller viralicidic activity 2 (S. cerevisiae homolog)-like,superkiller viralicidic activity 2-like homolog
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook