SKIV2L monoclonal antibody (M05), clone 1E5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant SKIV2L.
Immunogen
SKIV2L (NP_008860, 1125 a.a. ~ 1233 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DQLPNTLKQGIERVRAVAKRIGEVQVACGLNQTVEEFVGELNFGLVEVVYEWARGMPFSELAGLSGTPEGLVVRCIQRLAEMCRSLRGAARLVGEPVLGAKMETAATLL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SKIV2L monoclonal antibody (M05), clone 1E5. Western Blot analysis of SKIV2L expression in Hela S3 NE.Western Blot (Transfected lysate)
Western Blot analysis of SKIV2L expression in transfected 293T cell line by SKIV2L monoclonal antibody (M05), clone 1E5.
Lane 1: SKIV2L transfected lysate (Predicted MW: 137.06 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SKIV2L is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — SKIV2L
Entrez GeneID
6499GeneBank Accession#
NM_006929Protein Accession#
NP_008860Gene Name
SKIV2L
Gene Alias
170A, DDX13, HLP, SKI2, SKI2W, SKIV2
Gene Description
superkiller viralicidic activity 2-like (S. cerevisiae)
Omim ID
600478Gene Ontology
HyperlinkGene Summary
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a human homologue of yeast SKI2 and may be involved in antiviral activity by blocking translation of poly(A) deficient mRNAs. This gene is located in the class III region of the major histocompatibility complex. [provided by RefSeq
Other Designations
OTTHUMP00000029197|helicase SKI2W|superkiller viralicidic activity 2 (S. cerevisiae homolog)-like|superkiller viralicidic activity 2-like homolog
-
Interactomes
-
Pathways
-
Diseases
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com