Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ST3GAL3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00006487-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ST3GAL3 partial ORF ( NP_006270, 75 a.a. - 174 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • ATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006487-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6487
  • Gene Name:
  • ST3GAL3
  • Gene Alias:
  • SIAT6,ST3GALII,ST3GalIII,ST3N
  • Gene Description:
  • ST3 beta-galactoside alpha-2,3-sialyltransferase 3
  • Gene Summary:
  • The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase,Gal beta-1,3(4)GlcNAc alpha-2,3 sialyltransferase,OTTHUMP00000008811,OTTHUMP00000008812,OTTHUMP00000008820,OTTHUMP00000008821,OTTHUMP00000008822,OTTHUMP00000008823,ST3Gal III,alpha 2
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook