Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ST3GAL3 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00006487-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human ST3GAL3 protein.
  • Immunogen:
  • ST3GAL3 (NP_777624.1, 1 a.a. ~ 390 a.a) full-length human protein.
  • Sequence:
  • MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEEDSSKYSHSSSPQEKPVADSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of ST3GAL3 transfected lysate using anti-ST3GAL3 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ST3GAL3 purified MaxPab mouse polyclonal antibody (B01P) (H00006487-B01P).
  • PDF DownloadProtocol Download
  • Application Image
  • Gene Information
  • Entrez GeneID:
  • 6487
  • Gene Name:
  • ST3GAL3
  • Gene Alias:
  • SIAT6,ST3GALII,ST3GalIII,ST3N
  • Gene Description:
  • ST3 beta-galactoside alpha-2,3-sialyltransferase 3
  • Gene Summary:
  • The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase,Gal beta-1,3(4)GlcNAc alpha-2,3 sialyltransferase,OTTHUMP00000008811,OTTHUMP00000008812,OTTHUMP00000008820,OTTHUMP00000008821,OTTHUMP00000008822,OTTHUMP00000008823,ST3Gal III,alpha 2
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook