Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ST3GAL4 (Human) Recombinant Protein (Q01)

  • Catalog # : H00006484-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ST3GAL4 partial ORF ( NP_006269, 31 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • FYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRCVVVGNGHRLRNSSL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006484-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6484
  • Gene Name:
  • ST3GAL4
  • Gene Alias:
  • CGS23,FLJ11867,FLJ46764,NANTA3,SAT3,SIAT4,SIAT4C,ST3GalIV,STZ
  • Gene Description:
  • ST3 beta-galactoside alpha-2,3-sialyltransferase 4
  • Gene Summary:
  • Synthesis of alpha-2,3-linked sialic acid to Gal(beta-1,3)GalNAc is mediated by at least 3 distinct beta-galactoside alpha-2,3-sialyltransferases (EC 2.4.99.4), including ST3GAL4. In contrast, only a single gene encodes the beta-galactoside alpha-2,6-sialyltransferase (EC 2.4.99.1), ST6GAL1 (MIM 109675) (Chang et al., 1995 [PubMed 7655169]).[supplied by OMIM
  • Other Designations:
  • alpha-3-N-acetylneuraminyltransferase,sialyltransferase 4C (beta-galactosidase alpha-2,3-sialytransferase),sialyltransferase 4C (beta-galactoside alpha-2,3-sialytransferase)
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook