Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ST3GAL4 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00006484-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human ST3GAL4 protein.
  • Immunogen:
  • ST3GAL4 (ACE87320.1, 1 a.a. ~ 333 a.a) full-length human protein.
  • Sequence:
  • MVSKSRWKLLAMLALVLVVMVWYSISREDRYIELFYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRCVVVGNGHRLRNSSLGDAINKYDVVIRLNNAPVAGYEGDVGSKTTMRLFYPESAHFDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIAADKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMAGSGHNVSQEALAIKRMLEMGAIKNLTSF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Application Image
  • Western Blot (Transfected lysate)
  • Gene Information
  • Entrez GeneID:
  • 6484
  • Gene Name:
  • ST3GAL4
  • Gene Alias:
  • CGS23,FLJ11867,FLJ46764,NANTA3,SAT3,SIAT4,SIAT4C,ST3GalIV,STZ
  • Gene Description:
  • ST3 beta-galactoside alpha-2,3-sialyltransferase 4
  • Gene Summary:
  • Synthesis of alpha-2,3-linked sialic acid to Gal(beta-1,3)GalNAc is mediated by at least 3 distinct beta-galactoside alpha-2,3-sialyltransferases (EC 2.4.99.4), including ST3GAL4. In contrast, only a single gene encodes the beta-galactoside alpha-2,6-sialyltransferase (EC 2.4.99.1), ST6GAL1 (MIM 109675) (Chang et al., 1995 [PubMed 7655169]).[supplied by OMIM
  • Other Designations:
  • alpha-3-N-acetylneuraminyltransferase,sialyltransferase 4C (beta-galactosidase alpha-2,3-sialytransferase),sialyltransferase 4C (beta-galactoside alpha-2,3-sialytransferase)
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook