Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ST3GAL4 polyclonal antibody (A01)

  • Catalog # : H00006484-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ST3GAL4.
  • Immunogen:
  • ST3GAL4 (NP_006269, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • FYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRCVVVGNGHRLRNSSL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006484-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • ST3GAL4 polyclonal antibody (A01), Lot # 051207JC01. Western Blot analysis of ST3GAL4 expression in human ovarian cancer.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6484
  • Gene Name:
  • ST3GAL4
  • Gene Alias:
  • CGS23,FLJ11867,FLJ46764,NANTA3,SAT3,SIAT4,SIAT4C,ST3GalIV,STZ
  • Gene Description:
  • ST3 beta-galactoside alpha-2,3-sialyltransferase 4
  • Gene Summary:
  • Synthesis of alpha-2,3-linked sialic acid to Gal(beta-1,3)GalNAc is mediated by at least 3 distinct beta-galactoside alpha-2,3-sialyltransferases (EC 2.4.99.4), including ST3GAL4. In contrast, only a single gene encodes the beta-galactoside alpha-2,6-sialyltransferase (EC 2.4.99.1), ST6GAL1 (MIM 109675) (Chang et al., 1995 [PubMed 7655169]).[supplied by OMIM
  • Other Designations:
  • alpha-3-N-acetylneuraminyltransferase,sialyltransferase 4C (beta-galactosidase alpha-2,3-sialytransferase),sialyltransferase 4C (beta-galactoside alpha-2,3-sialytransferase)
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook