ST3GAL2 monoclonal antibody (M01), clone 1E12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ST3GAL2 monoclonal antibody (M01), clone 1E12 Western Blot analysis of ST3GAL2 expression in K-562 ( Cat # L009V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of ST3GAL2 expression in transfected 293T cell line by ST3GAL2 monoclonal antibody (M01), clone 1E12.
Lane 1: ST3GAL2 transfected lysate (Predicted MW: 40.2 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ST3GAL2 on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 1 ~ 10 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ST3GAL2 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ST3GAL2.
Immunogen
ST3GAL2 (NP_008858, 28 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HHSMATLPYLDSGALDGTHRVKLVPGYAGLQRLSKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFKSHNTNEV
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ST3GAL2 monoclonal antibody (M01), clone 1E12 Western Blot analysis of ST3GAL2 expression in K-562 ( Cat # L009V1 ).Western Blot (Transfected lysate)
Western Blot analysis of ST3GAL2 expression in transfected 293T cell line by ST3GAL2 monoclonal antibody (M01), clone 1E12.
Lane 1: ST3GAL2 transfected lysate (Predicted MW: 40.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ST3GAL2 on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 1 ~ 10 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ST3GAL2 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — ST3GAL2
Entrez GeneID
6483GeneBank Accession#
NM_006927Protein Accession#
NP_008858Gene Name
ST3GAL2
Gene Alias
Gal-NAc6S, SIAT4B, ST3GALII, ST3GalA.2
Gene Description
ST3 beta-galactoside alpha-2,3-sialyltransferase 2
Omim ID
607188Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi but can be proteolytically processed to a soluble form. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4A. [provided by RefSeq
Other Designations
CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase|Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase|alpha 2,3-ST|beta-galactoside alpha-2,3-sialytransferase|sialyltransferase 4B (beta-galactosidase alpha-2,3-sialytransferase)
-
Interactome
-
Pathway
-
Publication Reference
-
Ex-vivo Cultured Human Corneoscleral Segment Model to Study the Effects of Glaucoma Factors on Trabecular Meshwork.
Ramesh B Kasetti, Pinkal D Patel, Prabhavathi Maddineni, Gulab S Zode.
PLoS One 2020 Jun; 15(6):e0232111.
Application：IF, IHC, Human, Human corneoscleral segments.
-
Ex-vivo Cultured Human Corneoscleral Segment Model to Study the Effects of Glaucoma Factors on Trabecular Meshwork.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com