Product Browser

Last updated: 2017/7/23
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ST3GAL2 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00006483-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human ST3GAL2 protein.
  • Immunogen:
  • ST3GAL2 (NP_008858.1, 1 a.a. ~ 350 a.a) full-length human protein.
  • Sequence:
  • MKCSLRVWFLSVAFLLVFIMSLLFTYSHHSMATLPYLDSGALDGTHRVKLVPGYAGLQRLSKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPHQCRRCAVVGNSGNLRGSGYGQDVDGHNFIMRMNQAPTVGFEQDVGSRTTHHFMYPESAKNLPANVSFVLVPFKVLDLLWIASALSTGQIRFTYAPVKSFLRVDKEKVQIYNPAFFKYIHDRWTEHHGRYPSTGMLVLFFALHVCDEVNVYGFGADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • ST3GAL2 MaxPab rabbit polyclonal antibody. Western Blot analysis of ST3GAL2 expression in human kidney.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6483
  • Gene Name:
  • ST3GAL2
  • Gene Alias:
  • Gal-NAc6S,SIAT4B,ST3GALII,ST3GalA.2
  • Gene Description:
  • ST3 beta-galactoside alpha-2,3-sialyltransferase 2
  • Gene Summary:
  • The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi but can be proteolytically processed to a soluble form. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4A. [provided by RefSeq
  • Other Designations:
  • CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase,Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase,alpha 2,3-ST,beta-galactoside alpha-2,3-sialytransferase,sialyltransferase 4B (beta-galactosidase alpha-2,3-sialytransferase)
  • RSS
  • YouTube
  • Linkedin
  • Facebook