SIAH1 monoclonal antibody (M02), clone 2C5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SIAH1 monoclonal antibody (M02), clone 2C5. Western Blot analysis of SIAH1 expression in Jurkat(Cat # L017V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SIAH1 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SIAH1.
Immunogen
SIAH1 (NP_003022, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SIAH1 monoclonal antibody (M02), clone 2C5. Western Blot analysis of SIAH1 expression in Jurkat(Cat # L017V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SIAH1 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — SIAH1
Entrez GeneID
6477GeneBank Accession#
NM_003031Protein Accession#
NP_003022Gene Name
SIAH1
Gene Alias
FLJ08065, HUMSIAH, Siah-1, Siah-1a, hSIAH1
Gene Description
seven in absentia homolog 1 (Drosophila)
Omim ID
602212Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in the development of certain forms of Parkinson's disease, the regulation of the cellular response to hypoxia and induction of apoptosis. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized. [provided by RefSeq
Other Designations
seven in absentia homolog 1|sonic hedgehog homolog
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com