SHOX2 monoclonal antibody (M01J), clone 1D1

Catalog # H00006474-M01J

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 428.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Tissue lysate)
Application

Western Blot (Tissue lysate)

SHOX2 monoclonal antibody (M01), clone 1D1. Western Blot analysis of SHOX2 expression in human liver.

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

SHOX2 monoclonal antibody (M01J), clone 1D1. Western Blot analysis of SHOX2 expression in HeLa.

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

SHOX2 monoclonal antibody (M01J), clone 1D1. Western Blot analysis of SHOX2 expression in NIH/3T3.

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

SHOX2 monoclonal antibody (M01J), clone 1D1. Western Blot analysis of SHOX2 expression in PC-12.

Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of SHOX2 expression in transfected 293T cell line by SHOX2 monoclonal antibody (M01J), clone 1D1.

Lane 1: SHOX2 transfected lysate (Predicted MW: 37.6 KDa).
Lane 2: Non-transfected lysate.

Sandwich ELISA (Recombinant protein)
Application

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged SHOX2 is 0.1 ng/ml as a capture antibody.

Sandwich ELISA (Recombinant protein)
Application

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged SHOX2 is 0.03 ng/ml as a capture antibody.

RNAi Knockdown (Antibody validated)
Application

RNAi Knockdown (Antibody validated)

Western blot analysis of SHOX2 over-expressed 293 cell line, cotransfected with SHOX2 Validated Chimera RNAi ( Cat # H00006474-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with SHOX2 monoclonal antibody (M01), clone 1D1 (Cat # H00006474-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

QC Test

Western Blot detection against Immunogen (35.42 KDa) .

  • Specification

    Product Description

    Mouse monoclonal antibody raised against a partial recombinant SHOX2.
    This product is belong to Cell Culture Grade Antibody (CX Grade).Cell Culture Grade Antibody,Cell Culture Grade Antibodies,Cell Culture Grade,CX Grade,CXGrade

    Immunogen

    SHOX2 (NP_006875, 117 a.a. ~ 204 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    SPELKDRKDDAKGMEDEGQTKIKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHK

    Host

    Mouse

    Reactivity

    Human, Mouse, Rat

    Preparation Method

    Cell Culture Production

    Isotype

    IgG2a Kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (35.42 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Tissue lysate)

    SHOX2 monoclonal antibody (M01), clone 1D1. Western Blot analysis of SHOX2 expression in human liver.

    Western Blot (Cell lysate)

    SHOX2 monoclonal antibody (M01J), clone 1D1. Western Blot analysis of SHOX2 expression in HeLa.

    Western Blot (Cell lysate)

    SHOX2 monoclonal antibody (M01J), clone 1D1. Western Blot analysis of SHOX2 expression in NIH/3T3.

    Western Blot (Cell lysate)

    SHOX2 monoclonal antibody (M01J), clone 1D1. Western Blot analysis of SHOX2 expression in PC-12.

    Western Blot (Transfected lysate)

    Western Blot analysis of SHOX2 expression in transfected 293T cell line by SHOX2 monoclonal antibody (M01J), clone 1D1.

    Lane 1: SHOX2 transfected lysate (Predicted MW: 37.6 KDa).
    Lane 2: Non-transfected lysate.

    Western Blot (Recombinant protein)

    Sandwich ELISA (Recombinant protein)

    Detection limit for recombinant GST tagged SHOX2 is 0.1 ng/ml as a capture antibody.

    Sandwich ELISA (Recombinant protein)

    Detection limit for recombinant GST tagged SHOX2 is 0.03 ng/ml as a capture antibody.

    ELISA

    RNAi Knockdown (Antibody validated)

    Western blot analysis of SHOX2 over-expressed 293 cell line, cotransfected with SHOX2 Validated Chimera RNAi ( Cat # H00006474-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with SHOX2 monoclonal antibody (M01), clone 1D1 (Cat # H00006474-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • Gene Info — SHOX2

    Entrez GeneID

    6474

    GeneBank Accession#

    NM_006884

    Protein Accession#

    NP_006875

    Gene Name

    SHOX2

    Gene Alias

    OG12, OG12X, OGI2X, SHOT

    Gene Description

    short stature homeobox 2

    Omim ID

    602504

    Gene Ontology

    Hyperlink

    Gene Summary

    This gene is a member of the homeobox family of genes that encode proteins containing a 60-amino acid residue motif that represents a DNA binding domain. Homeobox genes have been characterized extensively as transcriptional regulators involved in pattern formation in both invertebrate and vertebrate species. Several human genetic disorders are caused by aberrations in human homeobox genes. This locus represents a pseudoautosomal homeobox gene that is thought to be responsible for idiopathic short stature, and it is implicated in the short stature phenotype of Turner syndrome patients. This gene is considered to be a candidate gene for Cornelia de Lange syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq

    Other Designations

    SHOX homologous gene on chromosome 3|short stature homeobox homolog

  • Interactome
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All