SHBG polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant SHBG.
Immunogen
SHBG (NP_001031, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag.
Sequence
DPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDS
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (79); Rat (79)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SHBG polyclonal antibody (A01), Lot # 051011JC01. Western Blot analysis of SHBG expression in NIH/3T3. (Isoform:31.829 kDa)Western Blot (Cell lysate)
SHBG polyclonal antibody (A01), Lot # 051011JC01 Western Blot analysis of SHBG expression in HepG2 ( Cat # L019V1 ).Western Blot (Cell lysate)
SHBG polyclonal antibody (A01), Lot # 051011JC01. Western Blot analysis of SHBG expression in PC-12. (Isoform:31.829 kDa)Western Blot (Cell lysate)
SHBG polyclonal antibody (A01), Lot # 051011JC01. Western Blot analysis of SHBG expression in Raw 264.7. (Isoform:31.829 kDa)Western Blot (Recombinant protein)
ELISA
-
Gene Info — SHBG
Entrez GeneID
6462GeneBank Accession#
NM_001040Protein Accession#
NP_001031Gene Name
SHBG
Gene Alias
ABP, MGC126834, MGC138391, TEBG
Gene Description
sex hormone-binding globulin
Omim ID
182205Gene Ontology
HyperlinkGene Summary
This gene encodes a steroid binding protein that was first described as a plasma protein secreted by the liver but is now thought to participate in the regulation of steroid responses. The encoded protein binds each steroid molecule as a dimer formed from identical or nearly identical monomers. The use of alternate promoters and alternatively spliced transcripts have been described. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000135293|androgen binding protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com